PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462852833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 359aa    MW: 39259.1 Da    PI: 6.3558
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462852833genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.42.4e-082973292254
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                ++yps +e+ +LA ++gL+  q+++WF N R +
  462852833 297 HPYPSDSEKLKLAVSTGLSRGQISNWFINARVR 329
                79*****************************88 PP

2BELL40.95.2e-141572261071
       BELL  10 akLlslleeVdkrYkqyv........eqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                akLl ll e++ r ++y          +l  v+ssFe + g  +a+ Ytsl ++a++rhF +L+ ai  +
  462852833 157 AKLLGLLSELESRQERYFgelgrvafSELGRVASSFEPALGPRAAAAYTSLMSQAMARHFGNLRRAILRR 226
                89*********9999998222222224556789**********************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-694225IPR006563POX domain
PfamPF075261.8E-1899223IPR006563POX domain
PROSITE profilePS5007111.953270333IPR001356Homeobox domain
SMARTSM003896.9E-8273337IPR001356Homeobox domain
SuperFamilySSF466898.13E-16284341IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-23285339IPR009057Homeodomain-like
CDDcd000865.62E-11286334No hitNo description
PfamPF059201.2E-16290329IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSLLFGQLNM VMSKHHEKGS PKQAPRAPVP GNSGDRSWQP PLQFEQCGHC NEQGCQAPGA  60
AAPLVLTLGP LGSAADRPCH RCSCGVAPGP APTPETVSML RGSRFLRPAQ ELLNEAVRMA  120
DVAGGGTGDD GEEAEEQERL EAGAHRAAKD DGDGVQAKLL GLLSELESRQ ERYFGELGRV  180
AFSELGRVAS SFEPALGPRA AAAYTSLMSQ AMARHFGNLR RAILRRLRLH AAAAARRRPA  240
PPLWESFPRA DGDVDDEDDD DEPVTDEKVD RVARRMKXXX XXXXXVLRAW LVKHFLHPYP  300
SDSEKLKLAV STGLSRGQIS NWFINARVRL WKPMIEEMYN DEFSEDHPLS NDTSGASSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-152863371263Homeobox protein Meis2
4xrm_B6e-152863371263Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0823962e-56AY082396.1 Zea mays knotted1-interacting protein (kip) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464082.15e-82hypothetical protein SORBIDRAFT_01g011970
TrEMBLW5EAW31e-83W5EAW3_WHEAT; Uncharacterized protein
STRINGSb01g011970.11e-81(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.25e-31BEL1-like homeodomain 3